The domain within your query sequence starts at position 103 and ends at position 218; the E-value for the VWA_N domain shown below is 6.7e-32.

AKKIREKFNRYLDVVNRNKQVVEASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSR
TVSCDRLSTTVNSRAFNPGRDLNSVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKF

VWA_N

VWA_N
PFAM accession number:PF08399
Interpro abstract (IPR013608):

This domain is found at the N terminus of proteins containing von Willebrand factor type A (VWA, IPR002035) and Cache (IPR004010) domains. It has been found in vertebrates, Drosophila melanogaster (Fruit fly) and Caenorhabditis elegans but has not yet been identified in other eukaryotes. It is probably involved in the function of some voltage-dependent calcium channel subunits [(PUBMED:11487633)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry VWA_N