The domain within your query sequence starts at position 373 and ends at position 430; the E-value for the Vac14_Fab1_bd domain shown below is 3.8e-9.

KYRHAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAACNAVGQMATDF

Vac14_Fab1_bd

Vac14_Fab1_bd
PFAM accession number:PF12755
Interpro abstract (IPR032878): This entry represents the Fab1-binding region of Vac14.

Vac14 is a component of the PI(3,5)P2 regulatory complex, which regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) [(PUBMED:19037259)]. This complex is composed of Atg18, Fig4, Fab1, Vac14 and Vac7 in yeast. In mammals it consists of PIKfyve, FIG4 and VAC14. Fab1/PIKfyve (Fab1 in yeast and PIKfyve in mammals) is a kinase that converts PI(3)P into PI(3,5)P2 by phosphorylation at the 5-position; conversely Fig4 dephosphorylates PI(3,5)P2 back to PI(3)P. Vac14 is a scaffolding adaptor protein whose multimerisation is a prerequisite step for PI(3,5)P2 complex assembly and function [(PUBMED:23389034)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vac14_Fab1_bd