The domain within your query sequence starts at position 542 and ends at position 720; the E-value for the Vac14_Fig4_bd domain shown below is 6.6e-82.
RKLLEARGPFIIRQLCLLLNAENIFHSMADILLREEDLKFASTMVHTLNTILLTSTELFQ LRNQLKDLQTPESQNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTVDF LTEVDKLVQLIECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCV
Vac14_Fig4_bd |
---|
PFAM accession number: | PF11916 |
---|---|
Interpro abstract (IPR021841): | Vac14 is a scaffold for the Fab1 kinase complex, a complex that allows for the dynamic interconversion of PI3P and PI(3,5)P2p (phosphoinositide phosphate (PIP) lipids, that are generated transiently on the cytoplasmic face of selected intracellular membranes) [ (PUBMED:19037259) ]. This interconversion is regulated by at least five proteins in yeast: the lipid kinase Fab1p, lipid phosphatase Fig4p, the Fab1p activator Vac7p, the Fab1p inhibitor Atg18p, and Vac14p, a protein required for the activity of both Fab1p and Fig4p. The full length Vac14 in yeasts is likely to be a protein carrying a succession of HEAT repeats, most of which have now degenerated. This regulatory system is crucial for the proper functioning of the mammalian nervous system [ (PUBMED:17956977) ]. This entry represents the C-terminal domain of Vac14, which binds to Fig4p. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vac14_Fig4_bd