The domain within your query sequence starts at position 395 and ends at position 491; the E-value for the Vasculin domain shown below is 1.9e-45.

TDVLSSSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISEQLQKNGLRKNGILK
NGLICDFKFGPWKNSTFKPTIENDDTETSSSDTSDDD

Vasculin

Vasculin
PFAM accession number:PF15337
Interpro abstract (IPR028128): Vasculin (also known as GC-rich promoter-binding protein, GPBP) functions as a GC-rich promoter-specific transcription factor [(PUBMED:14612417)].
GO process:positive regulation of transcription, DNA-templated (GO:0045893), transcription, DNA-templated (GO:0006351)
GO component:nucleus (GO:0005634)
GO function:DNA binding transcription factor activity (GO:0003700)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vasculin