The domain within your query sequence starts at position 45 and ends at position 291; the E-value for the Vasohibin domain shown below is 7e-124.

GGVLFHVNKSGFPIDSHTWERMWLHVAKVHPRGGEMVGAIRNAAFLAKPSIPQVPNYRLS
MTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVIL
GIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGYYGSLGMSRRAELMDKPLTFRT
LSDLVFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELE
KYARDMR

Vasohibin

Vasohibin
PFAM accession number:PF14822
Interpro abstract (IPR028131):

Angiogenesis, the formation of new vessels from existing ones, is a key event both under physiological and pathologic conditions. It is determined by the local balance between angiogenesis stimulators and inhibitors.

This entry represents a family of angiogenesis inhibitors consisting of vasohibin-1 (VASH1) and vasohibin-2 (VASH2) [(PUBMED:15467828), (PUBMED:16528006), (PUBMED:17095714)]. VASH1 is predominantly expressed in endothelial cells and it is induced by vascular endothelial growth factor (VEGF) or fibroblast growth factor 2 (FGF-2). VASH2 is thought to be expressed in cells other than endothelial cells [(PUBMED:23100270)].

GO process:regulation of angiogenesis (GO:0045765)
GO component:cytoplasm (GO:0005737)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vasohibin