The domain within your query sequence starts at position 68 and ends at position 312; the E-value for the Vasohibin domain shown below is 3.2e-122.
VPFFINRGGLPVDEATWERMWKHVAKIHPDGEKVALRIRGATDLPKIPIPSVPTFQPTTP VPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGI YLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFGGRYGALGMSRREDLMYKPPAFRTLS ELVLDYEAAYGRCWHVLKKVKLGQCVSHDPHSVEQIEWKHSVLDVERLGREDFRKELERH ARDMR
Vasohibin |
---|
PFAM accession number: | PF14822 |
---|---|
Interpro abstract (IPR028131): | This entry represents a family of tubulinyl-Tyr carboxypeptidases. These regulate microtubule function by removing a C-terminal tyrosine residue from alpha-tubulin [ (PUBMED:29146869) ]. Tubulinyl-Tyr carboxypeptidase 1 is also known as vasohibin-1 (VASH1), and it act as an angiogenesis inhibitor [ (PUBMED:15467828) (PUBMED:17095714) ]. VASH1 is predominantly expressed in endothelial cells and it is induced by vascular endothelial growth factor (VEGF) or fibroblast growth factor 2 (FGF-2). Tubulinyl-Tyr carboxypeptidase 2 (VASH2) is thought to be expressed in cells other than endothelial cells [ (PUBMED:16528006) (PUBMED:23100270) ]. Angiogenesis, the formation of new vessels from existing ones, is a key event both under physiological and pathologic conditions. It is determined by the local balance between angiogenesis stimulators and inhibitors. |
GO process: | regulation of angiogenesis (GO:0045765) |
GO component: | cytoplasm (GO:0005737) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vasohibin