The domain within your query sequence starts at position 21 and ends at position 51; the E-value for the Vg_Tdu domain shown below is 4.5e-21.

TEWNAGSVIFTYFEGDINSMVDEHFSRALRN

Vg_Tdu

Vg_Tdu
PFAM accession number:PF07545
Interpro abstract (IPR011520):

The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. Transcriptional activation by these proteins likely requires interactions with specific coactivators. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed. This short conserved region is needed for interaction with Sd [(PUBMED:10518497)].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vg_Tdu