The domain within your query sequence starts at position 78 and ends at position 204; the E-value for the Vma12 domain shown below is 1e-29.
ELLEGSDIYFPEIVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDAQCGGTLSDLG KQVRSVKALVVTIFNFIITVAAAFVCTYLGSQYVFTEMASRVLAALIVASVVGLAELYVM VRAMEGE
Vma12 |
---|
PFAM accession number: | PF11712 |
---|---|
Interpro abstract (IPR021013): | V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release [ (PUBMED:15629643) ]. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins [ (PUBMED:15907459) ]. Transmembrane ATPases are membrane-bound enzyme complexes/ion transporters that use ATP hydrolysis to drive the transport of protons across a membrane. Some transmembrane ATPases also work in reverse, harnessing the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. There are several different types of transmembrane ATPases, which can differ in function (ATP hydrolysis and/or synthesis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [ (PUBMED:15473999) (PUBMED:15078220) ]. The different types include:
The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterised member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localised to the endoplasmic reticulum [ (PUBMED:10340847) ]. |
GO process: | vacuolar proton-transporting V-type ATPase complex assembly (GO:0070072) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vma12