The domain within your query sequence starts at position 517 and ends at position 835; the E-value for the Vps16_C domain shown below is 5.5e-150.

VSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFT
VLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSFHIRA
SYAAEERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRIQRRLEDELGGRFLDLSL
HDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGY
LPFVEICMKQHNKHEAKKYASRVGPEQKVKALLLVGDVAQAAEVAIEHRNETELSLVLSH
CTGATDGAIADKIQRARAQ

Vps16_C

Vps16_C
PFAM accession number:PF04840
Interpro abstract (IPR006925):

Vps16 forms part of the Class C vacuolar protein sorting (Vps) complex. It is essential for vacuolar protein sorting, which is essential for viability in plants, but not yeast [(PUBMED:11702788)]. The Class C Vps complex is required for SNARE-mediated membrane fusion at the lysosome-like yeast vacuole. It is thought to play essential roles in membrane docking and fusion at the Golgi-to-endosome and endosome-to-vacuole stages of transport [(PUBMED:11422941)]. The role of VPS16 in this complex is not known.

GO process:intracellular protein transport (GO:0006886)
GO component:cytoplasm (GO:0005737)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps16_C