The domain within your query sequence starts at position 205 and ends at position 316; the E-value for the Vps16_N domain shown below is 1e-45.

ATCSAVEKLCEFNCNIRAPPKQMVWCSRPRSKERAVVVAWERRLMVVGNAPESIQFVLDE
DSYLVPELDGVRIFSRSTHEFLHEVPVASEEIFKIASMAPGALLLEAQKEYE

Vps16_N

Vps16_N
PFAM accession number:PF04841
Interpro abstract (IPR006926): This protein forms part of the Class C vacuolar protein sorting (Vps) complex. Vps16 is essential for vacuolar protein sorting, which is essential for viability in plants, but not yeast [(PUBMED:11702788)]. The Class C Vps complex is required for SNARE-mediated membrane fusion at the lysosome-like yeast vacuole. It is thought to play essential roles in membrane docking and fusion at the Golgi-to-endosome and endosome-to-vacuole stages of transport [(PUBMED:11422941)]. The role of VPS16 in this complex is not known.
GO process:intracellular protein transport (GO:0006886)
GO component:cytoplasm (GO:0005737)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps16_N