The domain within your query sequence starts at position 6 and ends at position 281; the E-value for the Vps26 domain shown below is 1e-135.

FGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLSLKNPNKRLEHQG
IKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYTGQNVK
LRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHL
KDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVRGESIP
IRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEE

Vps26

Vps26
PFAM accession number:PF03643
Interpro abstract (IPR028934):

VPS26 assembles into a multimeric complex with other vacuolar protein sorting proteins (VPSs) and plays a role in vesicular protein sorting [(PUBMED:11102511)]. This family also includes the related protein Down syndrome critical region protein 3 (DSCR3) and homologues [(PUBMED:9399594)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps26