The domain within your query sequence starts at position 449 and ends at position 551; the E-value for the Vps39_1 domain shown below is 1.7e-35.

IDTTLLKCYLHTNVALVAPLLRLENNHCHIEESEHVLKKAHKYSELIILYEKKGLHEKAL
QVLVDQSKKANSPLKGHERTVQYLQHLGTENLHLIFSYSVWVL

Vps39_1

Vps39_1
PFAM accession number:PF10366
Interpro abstract (IPR019452):

This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [ (PUBMED:9111041) (PUBMED:1493335) ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange [ (PUBMED:11062257) ]. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [ (PUBMED:9545258) (PUBMED:11278302) ]. The precise function of this domain has not been characterised.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps39_1