The domain within your query sequence starts at position 772 and ends at position 880; the E-value for the Vps39_2 domain shown below is 6.6e-36.

LQVLELHYSKLDTTKAINLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLR
VQEERILHQQVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKE

Vps39_2

Vps39_2
PFAM accession number:PF10367
Interpro abstract (IPR019453):

This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [(PUBMED:9111041), (PUBMED:1493335)]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange [(PUBMED:11062257)]. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [(PUBMED:9545258), (PUBMED:11278302)]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 [(PUBMED:11062257)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps39_2