The domain within your query sequence starts at position 635 and ends at position 680; the E-value for the Vps4_C domain shown below is 6.5e-9.

ADIATISPDQVRPIAYIDFENAFKTVRPTVSPKDLELYENWNETFG

Vps4_C

Vps4_C
PFAM accession number:PF09336
Interpro abstract (IPR015415):

This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting. It forms an alpha helix structure and is required for oligomerisation [ (PUBMED:16704411) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps4_C