The domain within your query sequence starts at position 179 and ends at position 398; the E-value for the Vps5 domain shown below is 6.3e-19.

TKEMFGGFFKSVVKSADEVLFSGVKEVDDFFEQEKNFLINYYNRIKDSCAKADKMTRSHK
NVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYY
MLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAETHQQECCQKFEQLSESAK
EELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCI

Vps5

Vps5
PFAM accession number:PF09325
Interpro abstract (IPR015404):

Vps5 is a sorting nexin that functions in membrane trafficking. This is the C-terminal dimerisation domain [(PUBMED:12181349)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps5