The domain within your query sequence starts at position 116 and ends at position 527; the E-value for the Vps52 domain shown below is 3e-181.

ITACDAVLEPRFLEQLQELDAKAAAVREQEAMGTAACADVRGVLDRLRVKAVTKIREFIL
QKIYSFRKPMTNYQIPQAALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSY
VGRLMKVQYEEVAEKDDLMGVEDTAKKGFFSKPSLRSRNTIFTLGTRGTVISPAELEAPI
LVPHTAQRGEQRYPFEALFRSQHYALLDNSCREYLFICEFFIVSGPAAHDLFHAVMGRTL
SMTLKHLESYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELI
LEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEFSSALVSINQTIPNERTLQLLGQLQVEV
ENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNA

Vps52

Vps52
PFAM accession number:PF04129
Interpro abstract (IPR007258): Vps52 complexes with Vps53 and Vps54 to form a multi-subunit complex involved in regulating membrane trafficking events [(PUBMED:10637310)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps52