The domain within your query sequence starts at position 226 and ends at position 276; the E-value for the Vps53_N domain shown below is 1.6e-14.

QGTKPKKPKAPDNPFHGIVSKCFEPHLYVYIESQDKNLSELIDRFVADFKA

Vps53_N

Vps53_N
PFAM accession number:PF04100
Interpro abstract (IPR007234):

Vps53 complexes with Vps52 and Vps54 to form a multi-subunit complex involved in regulating membrane trafficking events [ (PUBMED:10637310) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps53_N