The domain within your query sequence starts at position 39 and ends at position 101; the E-value for the Vps53_N domain shown below is 1.2e-21.
QADFNAVEYINTLFPTEQSLANIDDVVNKIRLKIRRLDDNIRTVVRGQTNVGQDGRQKKL ESP
Vps53_N |
![]() |
---|
PFAM accession number: | PF04100 |
---|---|
Interpro abstract (IPR007234): | Vps53 complexes with Vps52 and Vps54 to form a multi-subunit complex involved in regulating membrane trafficking events [ (PUBMED:10637310) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps53_N