SMART: Pfam domain Vps55

The domain within your query sequence starts at position 7 and ends at position 124; the E-value for the Vps55 domain shown below is 7.9e-43.

LVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSDATSSAC
RELAYFFTTGIVVSAFGLPVVLARVDVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGD

Vps55

PFAM accession number:	PF04133
Interpro abstract (IPR007262):	This entry includes Vps55 from budding yeasts and obesity receptor gene-related protein (OB-RGRP or LEPROT) from animals. Both Vps55 and OB-RGRP are important for functioning membrane trafficking to the vacuole/lysosome of eukaryotic cells [ (PUBMED:12006663) ]. Vps55 is involved in the secretion of the Golgi form of the soluble vacuolar carboxypeptidase Y, but not the trafficking of the membrane-bound vacuolar alkaline phosphatase [ (PUBMED:12006663) ]. The leptin receptor overlapping transcript (LEPROT) is co-transcribed with Leptin receptor (LepR) but without similarity to the LepR. Mammals have a single LEPROT homologue called LEPROT like-1 (LEPROTL1), which is also included in this entry. LepROT plays roles in insulin pathway [ (PUBMED:27106118) ]. LEPROT and LEPROTL1 have also been shown to influence liver growth hormone signaling in mice [ (PUBMED:19907080) ].

PFAM accession number:

PF04133

Interpro abstract (IPR007262):

This entry includes Vps55 from budding yeasts and obesity receptor gene-related protein (OB-RGRP or LEPROT) from animals. Both Vps55 and OB-RGRP are important for functioning membrane trafficking to the vacuole/lysosome of eukaryotic cells [ (PUBMED:12006663) ].

Vps55 is involved in the secretion of the Golgi form of the soluble vacuolar carboxypeptidase Y, but not the trafficking of the membrane-bound vacuolar alkaline phosphatase [ (PUBMED:12006663) ].

The leptin receptor overlapping transcript (LEPROT) is co-transcribed with Leptin receptor (LepR) but without similarity to the LepR. Mammals have a single LEPROT homologue called LEPROT like-1 (LEPROTL1), which is also included in this entry. LepROT plays roles in insulin pathway [ (PUBMED:27106118) ]. LEPROT and LEPROTL1 have also been shown to influence liver growth hormone signaling in mice [ (PUBMED:19907080) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps55