The domain within your query sequence starts at position 610 and ends at position 794; the E-value for the Vps8 domain shown below is 1.9e-61.

KGVFLECLEPYILSDKLVGITPQVMKDLIVHFQDKKLLENVEALIVHMDITSLDIQQVVL
MCWENRLYDAMVYVYNRGMNEFISPMEKLFKVIAPPLNAGKTLTDEQVVMGNKLLVYISC
CLAGRAYPLGDIPEDLVPLVKNQVFEFLIRLHSVEASSEEEVYPYVRTLLHFDTREFLNV
LALTF

Vps8

Vps8
PFAM accession number:PF12816
Interpro abstract (IPR025941):

Vps8 is one of the Golgi complex components necessary for vacuolar sorting [(PUBMED:8864656)]. Eukaryotic cells contain a highly dynamic endo-membrane system, in which individual organelles keep their identity despite continuous vesicle generation and fusion. Vesicles that bud from a donor membrane are targeted and delivered to each individual organelle, where they release their cargo after fusion with the acceptor membrane. Vps8 is the core component of the endosomal tethering complex CORVET (class C core vacuole/endosome tethering). Vps8 co-operates with Vps21-GTP to mediate endosomal clustering in a reaction that is dependent on Vps3. Vps8 is the only CORVET subunit that is enriched on late endosomes, suggesting that it is a marker for the maturation of late endosomes. Late endosomes form intralumenal vesicles, and the resulting multivesicular bodies fuse with the vacuole to release their cargoes [(PUBMED:19828734)].

This entry represents the central domain of Vps8.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps8