The domain within your query sequence starts at position 16 and ends at position 158; the E-value for the Vta1 domain shown below is 2.2e-50.

SIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLG
DNEAVTQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELT
DENVKHRKYARWKATYIHNCLKN

Vta1

Vta1
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vta1