The domain within your query sequence starts at position 82 and ends at position 150; the E-value for the W2 domain shown below is 7e-15.

AADHLEALAAIEDFFLEHETLVTSMAKVLMAFYQLEILAEETILSWFSQRDTTDEGQQLR
KNQQLSPLL

W2

W2
PFAM accession number:PF02020
Interpro abstract (IPR003307):

Translation initiation is a sophisticated, well regulated and highly coordinated cellular process in eukaryotes, in which at least 11 eukayrotic initiation factors (eIFs) are included. The W2 domain (two invariant tryptophans) is a region of ~165 amino acids which is found in the C terminus of the following eIFs [(PUBMED:8520487), (PUBMED:10958635), (PUBMED:14681227), (PUBMED:16616930), (PUBMED:16781736)]:

  • Eukaryotic translation initiation factor 2B epsilon (eIF-2B-epsilon).
  • Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma).
  • Eukaryotic translation initiation factor 5 (eIF-5), a GTPase-activating protein (GAP) specific for eIF2.

The W2 domain has a globular fold and is exclusively composed out of alpha- helices [(PUBMED:14681227), (PUBMED:16616930), (PUBMED:16781736)]. The structure can be divided into a structural C-terminal core onto which the two N-terminal helices are attached. The core contains two aromatic/acidic residue-rich regions (AA boxes), which are important for mediating protein-protein interactions.

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry W2