The domain within your query sequence starts at position 21 and ends at position 120; the E-value for the WAC_Acf1_DNA_bd domain shown below is 2.6e-28.

PLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEF
PNWYEKLVLEMVHHNTASLEKLVDSAWLEIMTKYAVGEEC

WAC_Acf1_DNA_bd

WAC_Acf1_DNA_bd
PFAM accession number:PF10537
Interpro abstract (IPR013136):

ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [(PUBMED:10385622), (PUBMED:12192034)].

Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WAC_Acf1_DNA_bd