The domain within your query sequence starts at position 32 and ends at position 604; the E-value for the WASH-7_N domain shown below is 4.8e-245.

GRFLEEYTSQLRRIEDALDDLIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKVI
TVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDSSMVEGDCQIQMGRFVSFLQELSCFV
TRCYEVVMNVIHQLAALYISNKIGPKIIETTGVHFQTMYEHLGELLTVLLTLDEIVDNHV
TLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFDS
LNGGISVSKNSTFAEEFAHSIRSIFANVEAKLGEPSEIDQRDKYVGICGLFVLHFQIFRT
VDKKFYKSLLDICKKVPAITLTANIIWFPDNFLIHKMPAAAKLLDRKSLQAIKIHRDTFL
QQKAQSLNKDVQSYYVFVSSWMMKMESMLSKEQRMDTFAEDLTNRCNVFIQGFLYAYSIS
TIIKTTMNLYMSMQKPMTKTSVKALCRLIELLKAIEHMFYRRSMVVADSVSHITQHLQHQ
ALSSISVAKKRVISDKKYSEQRLDVLSALVLAENTLNGPSTKQRRLIVSLALSVGTQMKT
FKDEELFPLQVVMKKLDLISELRERVQAQCDCC

WASH-7_N

WASH-7_N
PFAM accession number:PF14745
Interpro abstract (IPR028191):

This entry represents the N-terminal WASH homology domain (WAHD) of WASH complex subunit 7 (WASH7), also known as subunit 4 or KIAA1033 [(PUBMED:20888769)]. This domain comprises the WAHD1 and the TBR (tubulin-binding region) domains [(PUBMED:20888769)]. In species such as Drosophila this protein is the only component of the 'complex'. WASH is a complex present at the surface of endosomes that recruits and activates the Arp2/3 complex to induce actin polymerisation [(PUBMED:19922875)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WASH-7_N