The domain within your query sequence starts at position 70 and ends at position 176; the E-value for the WBP-1 domain shown below is 1.8e-50.

YLCETGHCCGETGCCTYYYELWWFWLLWTVLILFSCCCAFRHRRAKLRLQQQQRQREINL
LAYHGACHGAGPVPTGSLLDLRLLSAFKPPAYEDVVHHPGTPPPPYT

WBP-1

WBP-1
PFAM accession number:PF11669
Interpro abstract (IPR021684):

This entry includes WBP-1 and its homologous. WBP-1 is a ligand of the WW domain of Yes-associated protein. This protein has a proline-rich domain. WBP-1 does not bind to the SH3 domain [(PUBMED:7641887)]. This entry also includes transmembrane protein 92 (TMEM92), whose function is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WBP-1