The domain within your query sequence starts at position 204 and ends at position 279; the E-value for the WBS_methylT domain shown below is 1.1e-19.

LFSGPSTSLPKGLTESQDADQASESMFTSERAPHKKARRDLVKKSREWVLEKKERRRRQG
KEVRPDTQYTGRKRKP

WBS_methylT

WBS_methylT
PFAM accession number:PF12589
Interpro abstract (IPR022238):

This entry represents 18S rRNA (guanine(1575)-N(7))-methyltransferase Bud23 [(PUBMED:18332120)]. Bud23 homologues can be found from yeast to human. They are S-adenosyl-L-methionine-dependent methyltransferases that specifically methylates the N7 position of a guanine in 18S rRNA [(PUBMED:25851604)]. Bud23 homologue in Arabidopsis, known as Rid2 (ROOT INITIATION DEFECTIVE 2), is also involved in pre-rRNA processing [(PUBMED:21401745)].

In humans, Bud23 is located in the Williams-Beuren syndrome (WBS) critical region [(PUBMED:11978965)].

GO process:rRNA (guanine-N7)-methylation (GO:0070476)
GO function:rRNA (guanine) methyltransferase activity (GO:0016435)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WBS_methylT