The domain within your query sequence starts at position 508 and ends at position 564; the E-value for the WD40_3 domain shown below is 2.7e-32.

VNDYRHPVGVKKLFPDPNGTRLVFIDEKSDGFVYCPVNDATYEIPDFSPTIKGVLWE

WD40_3

WD40_3
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WD40_3