The domain within your query sequence starts at position 383 and ends at position 429; the E-value for the WD40_alt domain shown below is 4.3e-26.

LSSYLEKNMLGSQMLPARVFDLEDEVRSLRKINRDLFDFSTRIITRP

WD40_alt

 WD40_alt
PFAM accession number:PF14077
Interpro abstract (IPR026987):

WD repeats are short subdomains of about 40 amino acids and fold into 4 anti-parallel beta hairpins. The domain represented by this entry has been detected on the C terminus of WD repeat-containing protein 18 (Wdr18), which palys a role during development [ (PUBMED:21876750) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WD40_alt