The domain within your query sequence starts at position 351 and ends at position 400; the E-value for the WHIM1 domain shown below is 4.9e-8.
EYHHVLPYQEAEDYPYGPVENKIKVLQFLVDQFLTTNIAREELMSEGVIQ
WHIM1 |
![]() |
---|
PFAM accession number: | PF15612 |
---|---|
Interpro abstract (IPR028942): | WHIM1 is a conserved alpha helical motif that along with the WHIM2 and WHIM3 motifs, and the DDT domain comprise an alpha helical module found in diverse eukaryotic chromatin proteins [(PUBMED:22186017)].Based on the Ioc3 structure, this module is inferred to interact with nucleosomal linker DNA and the SLIDE domain of ISWI proteins [(PUBMED:22186017), (PUBMED:21525927)]. The resulting complex forms a protein ruler that measures out the spacing between two adjacent nucleosomes [(PUBMED:21525927)]. The conserved basic residue in WHIM1 is involved in packing with the DDT motif. The module shows a great domain architectural diversity and is often combined with other modified histone peptide recognizing and DNA binding domains, some of which discriminate methylated DNA [(PUBMED:22186017)]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WHIM1