The domain within your query sequence starts at position 1 and ends at position 73; the E-value for the WRW domain shown below is 1.4e-32.
MEVKLGELPSWIMMRDFTPSGIAGAFRRGYDRYYNKYINVRKGSISGISMVLAAYVVFSY CISYKELKHERRR
WRW |
![]() |
---|
PFAM accession number: | PF10206 |
---|---|
Interpro abstract (IPR019344): | This entry represents small proteins of approximately 110 amino acids, which are highly conserved from nematodes to humans. Some have been annotated in Swiss-Prot as being the f subunit of mitochondrial F1F0-ATP synthase but this could not be confirmed. The sequence has a well-conserved WRW motif. The exact function of the protein is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WRW