The domain within your query sequence starts at position 6 and ends at position 84; the E-value for the WRW domain shown below is 2.8e-22.
PLKEKKLMEVKLGELPSWIMMRDFTPSGIAGAFRRGYDRYYNKYINVRKGSISGISMVLA AYVVFSYCISYKELKHERR
WRW |
 |
|---|
| PFAM accession number: | PF10206 |
|---|---|
| Interpro abstract (IPR019344): | This entry represents small proteins of approximately 110 amino acids, which are highly conserved from nematodes to humans. Some have been annotated in Swiss-Prot as being the f subunit of mitochondrial F1F0-ATP synthase but this could not be confirmed. The sequence has a well-conserved WRW motif. The exact function of the protein is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WRW