The domain within your query sequence starts at position 119 and ends at position 200; the E-value for the WSC domain shown below is 3.7e-21.

NLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKH
GEAASTECNSVCFGDHTQPCGG

WSC

WSC
PFAM accession number:PF01822
Interpro abstract (IPR002889):

The WSC domain is a putative carbohydrate binding domain. The domain contains up to eight conserved cysteine residues that may be involved in disulphide bridges. The Trichoderma harzianum beta-1,3 exoglucanase contains two copies of the WSC domain, while the yeast SLG1 protein contains only one.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WSC