The domain within your query sequence starts at position 57 and ends at position 554; the E-value for the WTX domain shown below is 5.2e-199.

GMVRSRTHDGLAEVLVLEGSKKEEPPGGSDHSGARPIPGPPKPSGPGLGSLASSSVAKSH
SFFSLLKKNGRSETGKGDHAEASKAGGKQKRGLKGIFSSMRWHRRDKRGKEEEEKAVRAA
GPGNLVLPGSLTASLECVKEEPPRAARRPDSPGQDASRHAAGEPAGGEQAPASAESAPER
ICLEAGSPTGSGDQSSRGEDAEGHRREEKPGAALESGAGEVQAAEDASKTGDVPIKTVPL
VDSEGGSGRASAVPDPSSVDPPSDPSADRICLMFSDVTSLKSFDSLTGCGDIIADPEEEA
GPSCDKHVPGPGKPVLSKKNASVVAYQGGGEEMASPDQVDDTYLPEFWDMLSQTEDQGQG
TQEGAAKAATASDIKLAPETSSDTRCGEAAKDMSSVKRRRLHRIPIESQQKEEPKHPEKE
HQEGVPNSDEGYWDSTTPGPEEESISNSSSSKKVVIPRDSDSGDALCDLYVEPEASPATL
PATEDPPCLSRLKPVSPG

WTX

WTX
PFAM accession number:PF09422
Interpro abstract (IPR019003):

This entry includes APC membrane recruitment protein 1/2/3 (Amer1/2/3). Amer1, also known as WTX, binds to the tumour suppressor adenomatous polyposis coli and acts as an inhibitor of Wnt signaling by inducing beta-catenin degradation [(PUBMED:21498506)]. Amer2 is a negative regulator of Wnt/beta-catenin signaling involved in neuroectodermal patterning [(PUBMED:22128170)].

WTX is a novel gene mutated in a proportion of Wilms' tumors and in patients suffering from sclerosing bone dysplasia [(PUBMED:20843316)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WTX