The domain within your query sequence starts at position 1118 and ends at position 1176; the E-value for the WWE domain shown below is 7.5e-13.

SNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFTAGRRRYTVQFTTMVQGATTE

WWE

WWE
PFAM accession number:PF02825
Interpro abstract (IPR004170):

The WWE domain is named after three of its conserved residues and is predicted to mediate specific protein-protein interactions in ubiquitin and ADP ribose conjugation systems. This domain is found as a tandem repeat at the N-terminal of Deltex, a cytosolic effector of Notch signalling thought to bind the N-terminal of the Notch receptor [ (PUBMED:16271883) ]. It is also found as an interaction module in protein ubiquination and ADP ribosylation proteins [ (PUBMED:11343911) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WWE