The domain within your query sequence starts at position 695 and ends at position 772; the E-value for the WWE domain shown below is 1e-15.
TKWLWYWRNELNEYTQYGHESPSHTSSEINSAYLESFFHSCPRGVLQFHAGSQNYELSFQ GMIQTNIASKTQRHVVRR
WWE |
![]() |
---|
PFAM accession number: | PF02825 |
---|---|
Interpro abstract (IPR004170): | The WWE domain is named after three of its conserved residues and is predicted to mediate specific protein-protein interactions in ubiquitin and ADP ribose conjugation systems. This domain is found as a tandem repeat at the N-terminal of Deltex, a cytosolic effector of Notch signalling thought to bind the N-terminal of the Notch receptor [ (PUBMED:16271883) ]. It is also found as an interaction module in protein ubiquination and ADP ribosylation proteins [ (PUBMED:11343911) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WWE