The domain within your query sequence starts at position 1 and ends at position 248; the E-value for the Wtap domain shown below is 2.8e-157.
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLF FLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRI AQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQ QQQSQASA
Wtap |
---|
PFAM accession number: | PF17098 |
---|---|
Interpro abstract (IPR029732): | The Wtap family includes female-lethal(2)D from Drosophila and pre-mRNA-splicing regulator WTAP from mammals. The former is required for female-specific splicing of Sex-lethal RNA [ (PUBMED:1695150) ], and the latter is a regulatory subunit of the RNA N6-methyladenosine methyltransferase [ (PUBMED:24407421) ]. The family also includes the yeast Mum2p protein which is part of the Mis complex, a complex that mediates N6-methyladenosine methylation on some mRNAs during meiosis and is required for sporulation [ (PUBMED:22685417) (PUBMED:24269006) ]. |
GO process: | mRNA methylation (GO:0080009) |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Wtap