The domain within your query sequence starts at position 583 and ends at position 646; the E-value for the Wyosine_form domain shown below is 3.6e-29.
LGNPDFIEVKGVTYCGESAASSLTMANVPWHEEVVRFVRELVDLLPDYEVACEHEHSNCL LIGH
Wyosine_form |
 |
|---|
| PFAM accession number: | PF08608 |
|---|---|
| Interpro abstract (IPR013917): | The proteins in this entry appear to be important in wyosine base formation in a subset of phenylalanine specific tRNAs. It has been proposed that it participates in converting tRNA(Phe)-m(1)G(37) to tRNA(Phe)-yW [ (PUBMED:16162496) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Wyosine_form