The domain within your query sequence starts at position 583 and ends at position 646; the E-value for the Wyosine_form domain shown below is 3.6e-29.

LGNPDFIEVKGVTYCGESAASSLTMANVPWHEEVVRFVRELVDLLPDYEVACEHEHSNCL
LIGH

Wyosine_form

Wyosine_form
PFAM accession number:PF08608
Interpro abstract (IPR013917):

The proteins in this entry appear to be important in wyosine base formation in a subset of phenylalanine specific tRNAs. It has been proposed that it participates in converting tRNA(Phe)-m(1)G(37) to tRNA(Phe)-yW [(PUBMED:16162496)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Wyosine_form