The domain within your query sequence starts at position 110 and ends at position 333; the E-value for the XAP5 domain shown below is 2.7e-88.
RRERKRKISNLSFTLDEEEGDQEDSRQAESAEAHSAGAKKNLGKNPDVDTSFLPDREREE EENRLREELRQEWEAKREKVKGEEVEITFSYWDGSGHRRTVRMSKGSTVQQFLKRALQGL RRDFRELRAAGVEQLMYVKEDLILPHYHTFYDFIVAKARGKSGPLFSFDVHDDVRLLSDA TMEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDRYTI
XAP5 |
---|
PFAM accession number: | PF04921 |
---|---|
Interpro abstract (IPR007005): | These proteins are found in a wide range of eukaryotes. They are nuclear proteins, possibly with DNA-binding activity. XAP5 from Arabidopsis thaliana has been shown to be involved in light regulation of the circadian clock and photomorphogenesis [ (PUBMED:18515502) ]. |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry XAP5