The domain within your query sequence starts at position 99 and ends at position 132; the E-value for the XPA_N domain shown below is 1.5e-20.

FDYTICEECGKEFMDSYLMNHFDLPTCDSCRDAD

XPA_N

XPA_N
PFAM accession number:PF01286
Interpro abstract (IPR022652): Xeroderma pigmentosum (XP) [(PUBMED:8160271)] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) [(PUBMED:1918083)]. The sequence of the XPA protein is conserved from higher eukaryotes [(PUBMED:1764072)] to yeast (gene RAD14) [(PUBMED:1741034)]. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section.

This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to

This is a PFAM domain. For full annotation and more information, please see the PFAM entry XPA_N