The domain within your query sequence starts at position 1 and ends at position 227; the E-value for the XRN_N domain shown below is 8.4e-99.

MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKI
FTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGE
TLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHK
IMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREE

XRN_N

XRN_N
PFAM accession number:PF03159
Interpro abstract (IPR004859):

Signatures of this entry align residues towards the N terminus of several proteins with multiple functions. The members of this family all appear to possess 5'-3' exonuclease activity EC 3.1.11 . Thus, the aligned region may be necessary for 5'-3' exonuclease function.

GO function:exonuclease activity (GO:0004527), nucleic acid binding (GO:0003676)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry XRN_N