The domain within your query sequence starts at position 19 and ends at position 117; the E-value for the XTBD domain shown below is 1e-34.

VETLRCEGETDKHWRHRREFLLRNAGDLVPATDETADAESGARTRQLQQLVSFSMAWANH
VFLGCRYPQKVMDKILSMAEGIKVTDAPIHTTRDELVAK

XTBD

XTBD
PFAM accession number:PF11952
Interpro abstract (IPR021859):

XRN2 is an essential eukaryotic exoribonuclease that processes and degrades various substrates. The ~80-residue XRN2-binding domain (XTBD) constitutes an XRN2-binding module that is employed by different metazoan proteins to link to XRN2 [ (PUBMED:24462208) (PUBMED:26779609) ], such as:

  • Caenorhabditis elegans Partner of Xrn-Two protein 1, or PAXT-1 for short. Plays a role in maintenance of steady-state concentration and turnover of microRNAs (miRNA) by degradation of mature miRNA in complex with the exoribonuclease XRN-2 [ (PUBMED:24462208) ].
  • Mammalian CDKN2A-interacting protein (CDKN2AIP) or Collaborator of ARF (CARF) that regulates DNA damage response in a dose-dependent manner through a number of signaling pathways involved in cell proliferation, apoptosis [ (PUBMED:15109303) (PUBMED:24825908) ].
  • Mammalian CDKN2AIP N-terminal-like protein (CDKN2AIPNL).

The XTBD domain folds into a globular four-helix bundle (H1-H4) connected by three loops (L1-L3). H1-H3 form an antiparallel helical array and H4 folds back on top of H2 and H3 at a 90degree angle. The four-helical bundle is mainly stabilized by hydrophobic helix-helix interactions together with additional polar interactions between side chains located on neighbouring helices. The four-helix bundle of XTBD represents a structurally unique arrangement for XRN2 binding [ (PUBMED:26779609) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry XTBD