The domain within your query sequence starts at position 101 and ends at position 534; the E-value for the Xan_ur_permease domain shown below is 1.7e-93.

LCIFLGLQHYLTCFSGTIAVPFLLADAMCVGDDQWATSQLIGTIFFCVGITTLLQTTFGC
RLPLFQASAFAFLAPARAILSLDKWKCNTTEITVANGTAELLEHIWHPRIQEIQGAIIMS
SLIEVVIGLLGLPGALLRYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLL
FSQYARNVKFPLPIYKSKKGWTAYKFQLFKMFPIILAILVSWLLCFIFTVTDVFPSNSTD
YGYYARTDARKGVLLVAPWFKVPYPFQWGMPTVSAAGVIGMLSAVVASIIESIGDYYACA
RLSCAPPPPIHAINRGIFVEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQYG
AALMLGLGMVGKFSALFASLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGF
SIFFGLVLPSYLRQ

Xan_ur_permease

Xan_ur_permease
PFAM accession number:PF00860
Interpro abstract (IPR006043):

This entry represents a susbset of the wider APC (Amino acid-Polyamine-organoCation) superfamily of transporters [(PUBMED:10931886)]. Characterised proteins in this entry include:

  • Xanthine permease PbuX, involved in cellualar xanthine transport [(PUBMED:9098051)]
  • Uric acid permeases which promotes uptake of uric acid into the cell in limiting-nitrogen conditions [(PUBMED:11344136)]
  • Uracil permease [(PUBMED:8206848)]
  • Sodium-dependent vitamin C transporter, a sodium/ascorbate cotransporter mediating electrogenic uptake of Vitamin C [(PUBMED:11396616)]

These proteins generally contain 12 transmembrane regions. Many members of this family are uncharacterised and may transport other substrates eg. RutG is likely to transport pyrimidines into the cell [(PUBMED:16540542)].

GO process:transmembrane transport (GO:0055085)
GO component:membrane (GO:0016020)
GO function:transmembrane transporter activity (GO:0022857)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Xan_ur_permease