The domain within your query sequence starts at position 101 and ends at position 249; the E-value for the Xpo1 domain shown below is 3e-30.

SPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLR
IGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMA
NNKLLALLFEVLQQDKTSSNLHEAASDCV

Xpo1

Xpo1
PFAM accession number:PF08389
Interpro abstract (IPR013598):

The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane. Active transport of large molecules through these pore complexes require carrier proteins, called karyopherins (importins and exportins), which shuttle between the two compartments.

This domain is found close to the N terminus of yeast exportin 1 (Xpo1, Crm1, P14068), as well as adjacent to the N-terminal domain of importin-beta (IPR001494). Exportin 1 is a nuclear export receptor that translocates proteins out of the nucleus; it interacts with leucine-rich nuclear export signal (NES) sequences in proteins to be transported, as well as with RanGTP [(PUBMED:9323132), (PUBMED:9323123)]. Importin-beta is a nuclear import receptor that translocates proteins into the nucleus; it interacts with RanGTP and importin-alpha, the latter binding with the nuclear localisation signal (NLS) sequences in proteins to be transported [(PUBMED:17170104)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Xpo1