The domain within your query sequence starts at position 31 and ends at position 97; the E-value for the Xylo_C domain shown below is 2.1e-28.

SPNDFKPQDFLRLQVGTEWDPKERLFRNFGGLLGPLDEPVAMQRWARGPNLTATVVWIDP
TYVVATS

Xylo_C

Xylo_C
PFAM accession number:PF12529
Interpro abstract (IPR024448):

This entry represents a family of metazoan xylosyltransferases, which includes xylosyltransferase 1 and xylosyltransferase 2. These enzymes initiate the biosynthesis of glycosaminoglycan chains in proteoglycans by transferring xylose from UDP-xylose to specific serine residues of the core protein [(PUBMED:11099377)].

GO process:glycosaminoglycan biosynthetic process (GO:0006024)
GO function:protein xylosyltransferase activity (GO:0030158)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Xylo_C