The domain within your query sequence starts at position 169 and ends at position 244; the E-value for the YIF1 domain shown below is 2.5e-14.

RMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRM
YLTMAVAAAQPVLMYW

YIF1

YIF1
PFAM accession number:PF03878
Interpro abstract (IPR005578):

Yif1 (Yip1 interacting factor) is an integral membrane protein required for membrane fusion of ER derived vesicles [ (PUBMED:12657649) ]. It also plays a role in the biogenesis of ER derived COPII transport vesicles [ (PUBMED:15659647) ].

GO process:endoplasmic reticulum to Golgi vesicle-mediated transport (GO:0006888)
GO component:endoplasmic reticulum membrane (GO:0005789)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry YIF1