The domain within your query sequence starts at position 169 and ends at position 244; the E-value for the YIF1 domain shown below is 2.5e-14.
RMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRM YLTMAVAAAQPVLMYW
YIF1 |
---|
PFAM accession number: | PF03878 |
---|---|
Interpro abstract (IPR005578): | Yif1 (Yip1 interacting factor) is an integral membrane protein required for membrane fusion of ER derived vesicles [ (PUBMED:12657649) ]. It also plays a role in the biogenesis of ER derived COPII transport vesicles [ (PUBMED:15659647) ]. |
GO process: | endoplasmic reticulum to Golgi vesicle-mediated transport (GO:0006888) |
GO component: | endoplasmic reticulum membrane (GO:0005789) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry YIF1