The domain within your query sequence starts at position 5 and ends at position 216; the E-value for the YL1 domain shown below is 5.1e-58.

GGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDID
EGDEPSSDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVSTPASSSQKAREEKTLLPLELQD
DGSDSRKSMRQSTAEHTRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITEELNL
RSLETYERLEADKKKQVHKKRKCPGPIITYHS

YL1

 YL1
PFAM accession number:PF05764
Interpro abstract (IPR008895):

This entry include a group of proteins involved in chromatin remodelling, including Vps72 (vacuolar protein sorting-associated protein 72) from budding yeasts. Vps72 is a Htz1-binding component of the SWR1 complex, which is required for the incorporation of the histone variant H2AZ into chromatin [ (PUBMED:23580526) ]. It is also required for vacuolar protein sorting in budding yeasts [ (PUBMED:23580526) ].

The Vps72 homologue from flies, YL-1, is part of the Tip60 chromatin-remodelling complex which is involved in DNA repair [ (PUBMED:15528408) ].

GO process:chromatin remodeling (GO:0006338), regulation of transcription, DNA-templated (GO:0006355), histone exchange (GO:0043486)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry YL1