The domain within your query sequence starts at position 1303 and ends at position 1434; the E-value for the YTH domain shown below is 7.2e-50.

IRYFIMKSSNLRNLEISQQKGIWSTTPSNERKLNRAFWESSMVYLVFSVQGSGHFQGFSR
MSSEIGREKSQDWGSAGLGGVFKVEWIRKESLPFQFAHHLLNPWNDNKKVQISRDGQELE
PQVGEQLLQLWE

YTH

YTH
PFAM accession number:PF04146
Interpro abstract (IPR007275):

The YTH (YT521-B homology) domain has been suggested to be an evolutionarily conserved m6A-dependent RNA binding domain [(PUBMED:26318451)]. Proteins containing this domain includes mammalian YTHD and YTDC proteins, Arabidopsis CPSF30 (At1g30460), budding yeast Pho92 and fission yeast Mmi1.

In Saccharomyces cerevisiae, Pho92 is a posttranscriptional regulator that regulates Pho4 mRNA stability by binding to the 3'-UTR in a phosphate-dependent manner. Its YTH domain exhibits RNA-binding activity [(PUBMED:24206186)]. In Schizosaccharomyces pombe, Mmi1 has been identified as eliminating meiosis-specific mRNAs [(PUBMED:16823445)].

Rat YTHDC1 (also known as YT521-B) is an alternative splicing regulator that recognizes and binds N6-methyladenosine (m6A)-containing RNAs. The YTH domain of YT521-B is a RNA-binding domain with a very degenerate sequence-specificity [(PUBMED:25389274)].

GO function:RNA binding (GO:0003723)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry YTH