The domain within your query sequence starts at position 36 and ends at position 74; the E-value for the Yae1_N domain shown below is 2e-14.

GYQEGYEEGSSLGIVEGKRYGMVHGAKIGSEIGCYRGFA

Yae1_N

Yae1_N
PFAM accession number:PF09811
Interpro abstract (IPR019191):

This entry represents proteins found in the N-terminal region of the essential protein Yae1. Proteins containing this domain include ORAOV1 (Oral cancer-overexpressed protein 1) and YAE1 [(PUBMED:23318452)]. Their function is not clear. In Saccharomyces cerevisiae, Lto1 (ORAOV1 homologue) forms a complex with Rli1 and Yae1, which relieves the toxic effects of reactive oxygen species (ROS) on biogenesis and function of the ribosome [(PUBMED:23318452)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Yae1_N