The domain within your query sequence starts at position 7 and ends at position 288; the E-value for the YdjC domain shown below is 1.3e-68.

RLVVTADDFGYCPRRDEGIVEAFLAGTVTSVSLLVNGTAAESAAELARRHSIPTGLHANL
SEGRPVGPARHNASSLLSPEGFFLGKMGFREALAAGDVALPQVREELEAQLSRFRELLGR
SPTHVDGHQHVHVLPGVCQVFAEALQAYGVRFTRLPAERGVGSCAWLEAPARAFACTVER
DARAAIGPFSRHGLRWTDAFVGLSTCGRHMSAHRVLGSLARALEDIPAGHALTAELMAHP
GYPSVPPAGGCGEGPDAFSCSWERLHELHVLTAPTLRAWLAQ

YdjC

YdjC
PFAM accession number:PF04794
Interpro abstract (IPR006879): This entry includes YdjC deacetylase-like proteins [(PUBMED:18177738)], including chitooligosaccharide deacetylase ChbG [(PUBMED:22797760)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry YdjC