The domain within your query sequence starts at position 47 and ends at position 217; the E-value for the YhhN domain shown below is 1.2e-41.

WVSALIKCQPILCLVVFLWAVAPGGSSTWLLQGALVCSAVGDACLIWPEAFFYGTAAFSV
AHLFYLGAFGLTPLQPGLLLCTTLASLTYYSFLLLHLEQGMVLPVMAYGLILNSMLWRSL
VWGGSASWGAVLFTFSDGVLAWDTFVYSLPFARLVTMSTYYAAQLLLILSA

YhhN

YhhN
PFAM accession number:PF07947
Interpro abstract (IPR012506):

The members of this family are similar to the hypothetical protein yhhN expressed by E. coli (P0ADI9). Many are annotated as possible transmembrane proteins, and in fact they all have a high proportion of hydrophobic residues. A human member of this family, formerly known as TMEM86B, is a lysoplasmalogenase that catalyzes the hydrolysis of the vinyl ether bond of lysoplasmalogen [(PUBMED:21515882)]. Putative conserved active site residues have been proposed for the YhhN family [(PUBMED:26335199)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry YhhN